SCYL1 monoclonal antibody (M02), clone 2E5 View larger

SCYL1 monoclonal antibody (M02), clone 2E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCYL1 monoclonal antibody (M02), clone 2E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re

More info about SCYL1 monoclonal antibody (M02), clone 2E5

Brand: Abnova
Reference: H00057410-M02
Product name: SCYL1 monoclonal antibody (M02), clone 2E5
Product description: Mouse monoclonal antibody raised against a partial recombinant SCYL1.
Clone: 2E5
Isotype: IgG2a Kappa
Gene id: 57410
Gene name: SCYL1
Gene alias: GKLP|HT019|MGC78454|NKTL|NTKL|P105|TAPK|TEIF|TRAP
Gene description: SCY1-like 1 (S. cerevisiae)
Genbank accession: BC009967
Immunogen: SCYL1 (AAH09967, 373 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP
Protein accession: AAH09967
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057410-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00057410-M02-1-25-1.jpg
Application image note: SCYL1 monoclonal antibody (M02), clone 2E5. Western Blot analysis of SCYL1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Identification of Tyrosine-Phosphorylated Proteins Associated with Lung Cancer Metastasis using Label-Free Quantitative Analyses.Wu HY, Tseng VS, Chen LC, Chang HY, Chuang IC, Tsay YG, Liao PC.
J Proteome Res. 2010 Jun 23. [Epub ahead of print]

Reviews

Buy SCYL1 monoclonal antibody (M02), clone 2E5 now

Add to cart