RAB22A monoclonal antibody (M03), clone 2B12 View larger

RAB22A monoclonal antibody (M03), clone 2B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB22A monoclonal antibody (M03), clone 2B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RAB22A monoclonal antibody (M03), clone 2B12

Brand: Abnova
Reference: H00057403-M03
Product name: RAB22A monoclonal antibody (M03), clone 2B12
Product description: Mouse monoclonal antibody raised against a full-length recombinant RAB22A.
Clone: 2B12
Isotype: IgG2b Kappa
Gene id: 57403
Gene name: RAB22A
Gene alias: MGC16770
Gene description: RAB22A, member RAS oncogene family
Genbank accession: BC015710
Immunogen: RAB22A (AAH15710, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALRELRVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRRHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC
Protein accession: AAH15710
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057403-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057403-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged RAB22A is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAB22A monoclonal antibody (M03), clone 2B12 now

Add to cart