Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RHOJ monoclonal antibody (M01), clone 1E4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about RHOJ monoclonal antibody (M01), clone 1E4
| Brand: | Abnova |
| Reference: | H00057381-M01 |
| Product name: | RHOJ monoclonal antibody (M01), clone 1E4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RHOJ. |
| Clone: | 1E4 |
| Isotype: | IgG1 lambda |
| Gene id: | 57381 |
| Gene name: | RHOJ |
| Gene alias: | ARHJ|FLJ14445|MGC34777|RASL7B|TC10B|TCL |
| Gene description: | ras homolog gene family, member J |
| Genbank accession: | BC062575 |
| Immunogen: | RHOJ (AAH62575, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII |
| Protein accession: | AAH62575 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (49.28 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to RHOJ on HeLa cell. [antibody concentration 60 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | RhoJ and Pak Kinases Regulate Melanoma Chemoresistance by Suppressing Pathways that Sense DNA Damage.Ho H, Aruri J, Kapadia R, Mehr H, White MA, Ganesan AK. Cancer Res. 2012 Sep 12. [Epub ahead of print] |