KIR2DL5A purified MaxPab rabbit polyclonal antibody (D01P) View larger

KIR2DL5A purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIR2DL5A purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about KIR2DL5A purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00057292-D01P
Product name: KIR2DL5A purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human KIR2DL5A protein.
Gene id: 57292
Gene name: KIR2DL5A
Gene alias: CD158F|KIR2DL5|KIR2DL5.1|KIR2DL5.3
Gene description: killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A
Genbank accession: BC160063.1
Immunogen: KIR2DL5A (AAI60063.1, 1 a.a. ~ 375 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
Protein accession: AAI60063.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00057292-D01P-13-15-1.jpg
Application image note: Western Blot analysis of KIR2DL5A expression in transfected 293T cell line (H00057292-T01) by KIR2DL5A MaxPab polyclonal antibody.

Lane 1: KIR2DL5A transfected lysate(41.25 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KIR2DL5A purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart