Cart 178 Product Products 84 424,00 € (empty)
No products
To be determined Shipping
84 424,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 178 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 84 424,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 84 424,00 €
Data sheet of KIR2DL5A purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about KIR2DL5A purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00057292-B01P |
| Product name: | KIR2DL5A purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human KIR2DL5A protein. |
| Gene id: | 57292 |
| Gene name: | KIR2DL5A |
| Gene alias: | CD158F|KIR2DL5|KIR2DL5.1|KIR2DL5.3 |
| Gene description: | killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A |
| Genbank accession: | BC160063.1 |
| Immunogen: | KIR2DL5A (AAI60063.1, 1 a.a. ~ 375 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI |
| Protein accession: | AAI60063.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of KIR2DL5A expression in transfected 293T cell line (H00057292-T01) by KIR2DL5A MaxPab polyclonal antibody. Lane 1: KIR2DL5A transfected lysate(41.25 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |