SLC39A10 polyclonal antibody (A01) View larger

SLC39A10 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC39A10 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLC39A10 polyclonal antibody (A01)

Brand: Abnova
Reference: H00057181-A01
Product name: SLC39A10 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SLC39A10.
Gene id: 57181
Gene name: SLC39A10
Gene alias: DKFZp781L10106|LZT-Hs2|MGC126565|MGC138428
Gene description: solute carrier family 39 (zinc transporter), member 10
Genbank accession: NM_020342
Immunogen: SLC39A10 (NP_065075, 514 a.a. ~ 621 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: CIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGLHTIHEHDL
Protein accession: NP_065075
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057181-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC39A10 polyclonal antibody (A01) now

Add to cart