Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SMURF1 monoclonal antibody (M01), clone 1D7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about SMURF1 monoclonal antibody (M01), clone 1D7
| Brand: | Abnova |
| Reference: | H00057154-M01 |
| Product name: | SMURF1 monoclonal antibody (M01), clone 1D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SMURF1. |
| Clone: | 1D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 57154 |
| Gene name: | SMURF1 |
| Gene alias: | KIAA1625 |
| Gene description: | SMAD specific E3 ubiquitin protein ligase 1 |
| Genbank accession: | NM_020429 |
| Immunogen: | SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP |
| Protein accession: | NP_065162 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SMURF1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 2 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | BMPR2 Mutation-independent Mechanisms of Disrupted BMP Signaling in IPAH.Barnes JW, Kucera ET, Tian L, Mellor NE, Dvorina N, Baldwin Iii WW, Aldred MA, Farver CF, Comhair SA, Aytekin M, Dweik RA. Am J Respir Cell Mol Biol. 2016 May 17. [Epub ahead of print] |