H00057153-M02_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00057153-M02 |
Product name: | SLC44A2 monoclonal antibody (M02), clone 1D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC44A2. |
Clone: | 1D5 |
Isotype: | IgG2b Kappa |
Gene id: | 57153 |
Gene name: | SLC44A2 |
Gene alias: | CTL2|DKFZp666A071|FLJ44586|PP1292 |
Gene description: | solute carrier family 44, member 2 |
Genbank accession: | BC040556 |
Immunogen: | SLC44A2 (AAH40556, 123 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV |
Protein accession: | AAH40556 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SLC44A2 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |