SLC44A2 monoclonal antibody (M02), clone 1D5 View larger

SLC44A2 monoclonal antibody (M02), clone 1D5

H00057153-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC44A2 monoclonal antibody (M02), clone 1D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SLC44A2 monoclonal antibody (M02), clone 1D5

Brand: Abnova
Reference: H00057153-M02
Product name: SLC44A2 monoclonal antibody (M02), clone 1D5
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC44A2.
Clone: 1D5
Isotype: IgG2b Kappa
Gene id: 57153
Gene name: SLC44A2
Gene alias: CTL2|DKFZp666A071|FLJ44586|PP1292
Gene description: solute carrier family 44, member 2
Genbank accession: BC040556
Immunogen: SLC44A2 (AAH40556, 123 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV
Protein accession: AAH40556
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057153-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057153-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC44A2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC44A2 monoclonal antibody (M02), clone 1D5 now

Add to cart