Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CTL2 monoclonal antibody (M01), clone 3D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about CTL2 monoclonal antibody (M01), clone 3D11
| Brand: | Abnova |
| Reference: | H00057153-M01 |
| Product name: | CTL2 monoclonal antibody (M01), clone 3D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CTL2. |
| Clone: | 3D11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 57153 |
| Gene name: | SLC44A2 |
| Gene alias: | CTL2|DKFZp666A071|FLJ44586|PP1292 |
| Gene description: | solute carrier family 44, member 2 |
| Genbank accession: | BC040556 |
| Immunogen: | CTL2 (AAH40556, 123 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV |
| Protein accession: | AAH40556 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SLC44A2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification and functional analysis of choline transporter in tongue cancer: A novel molecular target for tongue cancer therapy.Nishiyama R, Nagashima F, Iwao B, Kawai Y, Inoue K, Midori A, Yamanaka T, Uchino H, Inazu M. Journal of Pharmacological Sciences. 2016 May 1. [Epub ahead of print] |