View larger

SLURP1 purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of SLURP1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00057152-D01P
Product name:	SLURP1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human SLURP1 protein.
Gene id:	57152
Gene name:	SLURP1
Gene alias:	ANUP\|ARS\|ArsB\|LY6LS\|MDM
Gene description:	secreted LY6/PLAUR domain containing 1
Genbank accession:	NM_020427
Immunogen:	SLURP1 (NP_065160.1, 1 a.a. ~ 103 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Protein accession:	NP_065160.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of SLURP1 expression in transfected 293T cell line (H00057152-T01) by SLURP1 MaxPab polyclonal antibody. Lane 1: SLURP1 transfected lysate(11.20 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice
Publications:	Corneal Expression of SLURP-1 by Age, Sex, Genetic Strain, and Ocular Surface Health.Swamynathan S, Delp EE, Harvey SAK, Loughner CL, Raju L, Swamynathan SK. iovs. 2015 Dec. 56:7888.