Brand: | Abnova |
Reference: | H00057143-M03 |
Product name: | ADCK1 monoclonal antibody (M03), clone 4B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADCK1. |
Clone: | 4B10 |
Isotype: | IgG2a Kappa |
Gene id: | 57143 |
Gene name: | ADCK1 |
Gene alias: | FLJ39600 |
Gene description: | aarF domain containing kinase 1 |
Genbank accession: | BC058906 |
Immunogen: | ADCK1 (AAH58906.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MARKALKLASWTSMALAASGIYFYSNKYLDPNDFGAVRVGRAVATTAVISYDYLTSLKSVPYGSEEYLQLRSKVHLRSARRLCELCCANRGTFIKVGQHL |
Protein accession: | AAH58906.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ADCK1 is 10 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |