ADCK1 monoclonal antibody (M01), clone 1E8 View larger

ADCK1 monoclonal antibody (M01), clone 1E8

H00057143-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADCK1 monoclonal antibody (M01), clone 1E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ADCK1 monoclonal antibody (M01), clone 1E8

Brand: Abnova
Reference: H00057143-M01
Product name: ADCK1 monoclonal antibody (M01), clone 1E8
Product description: Mouse monoclonal antibody raised against a partial recombinant ADCK1.
Clone: 1E8
Isotype: IgG2a Kappa
Gene id: 57143
Gene name: ADCK1
Gene alias: FLJ39600
Gene description: aarF domain containing kinase 1
Genbank accession: BC058906
Immunogen: ADCK1 (AAH58906.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MARKALKLASWTSMALAASGIYFYSNKYLDPNDFGAVRVGRAVATTAVISYDYLTSLKSVPYGSEEYLQLRSKVHLRSARRLCELCCANRGTFIKVGQHL
Protein accession: AAH58906.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057143-M01-9-17-1.jpg
Application image note: Detection limit for recombinant GST tagged ADCK1 is 10 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ADCK1 monoclonal antibody (M01), clone 1E8 now

Add to cart