ZNF695 purified MaxPab mouse polyclonal antibody (B01P) View larger

ZNF695 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF695 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ZNF695 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00057116-B01P
Product name: ZNF695 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ZNF695 protein.
Gene id: 57116
Gene name: ZNF695
Gene alias: MGC61907|RP11-551G24.1|SBZF3
Gene description: zinc finger protein 695
Genbank accession: NM_020394.2
Immunogen: ZNF695 (AAH23527.1, 1 a.a. ~ 133 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGLLAFRDVALEFSPEEWECLDPAQRSLYRDVMLENYRNLISLGEDSFNMQFLFHSLAMSKPELIICLEARKEPWNVNTEKTAKHSALSSYLTEDILPEQGLQVSFQKVMLRRYERCCLEKLRLRNDWEIVAM
Protein accession: AAH23527.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057116-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ZNF695 expression in transfected 293T cell line (H00057116-T01) by ZNF695 MaxPab polyclonal antibody.

Lane 1: ZNF695 transfected lysate(14.63 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF695 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart