TRIM49 monoclonal antibody (M04), clone 2A3 View larger

TRIM49 monoclonal antibody (M04), clone 2A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM49 monoclonal antibody (M04), clone 2A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TRIM49 monoclonal antibody (M04), clone 2A3

Brand: Abnova
Reference: H00057093-M04
Product name: TRIM49 monoclonal antibody (M04), clone 2A3
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM49.
Clone: 2A3
Isotype: IgG2a Lambda
Gene id: 57093
Gene name: TRIM49
Gene alias: RNF18
Gene description: tripartite motif-containing 49
Genbank accession: NM_020358
Immunogen: TRIM49 (NP_065091, 251 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGK
Protein accession: NP_065091
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057093-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057093-M04-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TRIM49 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TRIM49 monoclonal antibody (M04), clone 2A3 now

Add to cart