Brand: | Abnova |
Reference: | H00057093-M03 |
Product name: | TRIM49 monoclonal antibody (M03), clone 3H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM49. |
Clone: | 3H8 |
Isotype: | IgG2a Kappa |
Gene id: | 57093 |
Gene name: | TRIM49 |
Gene alias: | RNF18 |
Gene description: | tripartite motif-containing 49 |
Genbank accession: | NM_020358 |
Immunogen: | TRIM49 (NP_065091, 251 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGK |
Protein accession: | NP_065091 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TRIM49 monoclonal antibody (M03), clone 3H8 Western Blot analysis of TRIM49 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |