SAS10 MaxPab mouse polyclonal antibody (B01) View larger

SAS10 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SAS10 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about SAS10 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00057050-B01
Product name: SAS10 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human SAS10 protein.
Gene id: 57050
Gene name: UTP3
Gene alias: CRL1|CRLZ1|FLJ23256|SAS10
Gene description: UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
Genbank accession: NM_020368.1
Immunogen: SAS10 (NP_065101.1, 1 a.a. ~ 479 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAALAKGWNEVQSGDEEDGEEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACAVTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK
Protein accession: NP_065101.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057050-B01-13-15-1.jpg
Application image note: Western Blot analysis of UTP3 expression in transfected 293T cell line (H00057050-T01) by UTP3 MaxPab polyclonal antibody.

Lane1:SAS10 transfected lysate(52.69 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SAS10 MaxPab mouse polyclonal antibody (B01) now

Add to cart