Cart 55 Product Products 14 767,17 € (empty)
-
-
-
-
-
-
1 x Cortactin...259,07 € -
-
1 x TIGD1...259,07 € -
-
-
-
-
-
-
1 x MLK1/2...259,07 € -
-
-
-
-
-
1 x EphB6...259,07 € -
1 x Phospho-p3...259,07 € -
-
-
-
-
-
1 x RDM1...259,07 € -
-
-
-
-
1 x FoxD4L1...259,07 € -
1 x EphA3...259,07 € -
1 x Granzyme...259,07 € -
-
-
-
1 x MRP-L35...259,07 € -
-
-
-
-
-
-
1 x EMR1...259,07 € -
1 x Mnk1...259,07 € -
1 x ALPP/ALPPL...259,07 € -
-
-
-
-
1 x Phospho-AL...259,07 € -
1 x Mob3A/B...259,07 € -
No products
To be determined Shipping
14 767,17 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 55 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 14 767,17 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 14 767,17 €
Data sheet of PLSCR3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about PLSCR3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00057048-D01P |
| Product name: | PLSCR3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PLSCR3 protein. |
| Gene id: | 57048 |
| Gene name: | PLSCR3 |
| Gene alias: | - |
| Gene description: | phospholipid scramblase 3 |
| Genbank accession: | BC011735.2 |
| Immunogen: | PLSCR3 (AAH11735.1, 1 a.a. ~ 295 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS |
| Protein accession: | AAH11735.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of PLSCR3 expression in transfected 293T cell line (H00057048-T02) by PLSCR3 MaxPab polyclonal antibody. Lane 1: PLSCR3 transfected lysate(31.70 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |