Brand: | Abnova |
Reference: | H00057019-A01 |
Product name: | CIAPIN1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CIAPIN1. |
Gene id: | 57019 |
Gene name: | CIAPIN1 |
Gene alias: | 2810413N20Rik|Anamorsin|DRE2|PRO0915 |
Gene description: | cytokine induced apoptosis inhibitor 1 |
Genbank accession: | NM_020313 |
Immunogen: | CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA |
Protein accession: | NP_064709 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CIAPIN1 polyclonal antibody (A01), Lot # 060516JCS1 Western Blot analysis of CIAPIN1 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |