Brand: | Abnova |
Reference: | H00057016-M01 |
Product name: | AKR1B10 monoclonal antibody (M01), clone 1A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKR1B10. |
Clone: | 1A6 |
Isotype: | IgG2a Kappa |
Gene id: | 57016 |
Gene name: | AKR1B10 |
Gene alias: | AKR1B11|AKR1B12|ALDRLn|ARL-1|ARL1|HIS|HSI|MGC14103 |
Gene description: | aldo-keto reductase family 1, member B10 (aldose reductase) |
Genbank accession: | NM_020299 |
Immunogen: | AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE |
Protein accession: | NP_064695 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.22 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Quantification of the Host Response Proteome after Herpes Simplex 1 Virus infection.Berard AR, Coombs KM, Severini A J Proteome Res. 2015 Apr 15. |