Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AKR1B10 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about AKR1B10 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00057016-A01 |
| Product name: | AKR1B10 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant AKR1B10. |
| Gene id: | 57016 |
| Gene name: | AKR1B10 |
| Gene alias: | AKR1B11|AKR1B12|ALDRLn|ARL-1|ARL1|HIS|HSI|MGC14103 |
| Gene description: | aldo-keto reductase family 1, member B10 (aldose reductase) |
| Genbank accession: | NM_020299 |
| Immunogen: | AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE |
| Protein accession: | NP_064695 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.59 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | AKR1B10 polyclonal antibody (A01), Lot # UOP11060207QCS1 Western Blot analysis of AKR1B10 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | SUOX is a Promising Diagnostic and Prognostic Biomarker for Hepatocellular Carcinoma.Jin GZ, Yu WL, Dong H, Zhou WP, Gu YJ, Yu H, Yu H, Lu XY, Xian ZH, Liu YK, Cong WM, Wu MC J Hepatol. 2013 May 8. pii: S0168-8278(13)00283-3. doi: 10.1016/j.jhep.2013.04.028. |