CABC1 monoclonal antibody (M05A), clone 8F7 View larger

CABC1 monoclonal antibody (M05A), clone 8F7

H00056997-M05A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CABC1 monoclonal antibody (M05A), clone 8F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CABC1 monoclonal antibody (M05A), clone 8F7

Brand: Abnova
Reference: H00056997-M05A
Product name: CABC1 monoclonal antibody (M05A), clone 8F7
Product description: Mouse monoclonal antibody raised against a partial recombinant CABC1.
Clone: 8F7
Isotype: IgM Kappa
Gene id: 56997
Gene name: CABC1
Gene alias: ADCK3|ARCA2|COQ8|MGC4849|SCAR9
Gene description: chaperone, ABC1 activity of bc1 complex homolog (S. pombe)
Genbank accession: BC005171
Immunogen: CABC1 (AAH05171, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD
Protein accession: AAH05171
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056997-M05A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056997-M05A-1-25-1.jpg
Application image note: CABC1 monoclonal antibody (M05A), clone 8F7 Western Blot analysis of CABC1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CABC1 monoclonal antibody (M05A), clone 8F7 now

Add to cart