Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CABC1 monoclonal antibody (M04A), clone 7G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CABC1 monoclonal antibody (M04A), clone 7G1
| Brand: | Abnova |
| Reference: | H00056997-M04A |
| Product name: | CABC1 monoclonal antibody (M04A), clone 7G1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CABC1. |
| Clone: | 7G1 |
| Isotype: | IgM Kappa |
| Gene id: | 56997 |
| Gene name: | CABC1 |
| Gene alias: | ADCK3|ARCA2|COQ8|MGC4849|SCAR9 |
| Gene description: | chaperone, ABC1 activity of bc1 complex homolog (S. pombe) |
| Genbank accession: | BC005171 |
| Immunogen: | CABC1 (AAH05171, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD |
| Protein accession: | AAH05171 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | CABC1 monoclonal antibody (M04A), clone 7G1 Western Blot analysis of CABC1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Decreased Coenzyme Q10 Levels in Multiple System Atrophy Cerebellum.Barca E, Kleiner G, Tang G, Ziosi M, Tadesse S, Masliah E, Louis ED, Faust P, Kang UJ, Torres J, Cortes EP, Vonsattel JG, Kuo SH, Quinzii CM. J Neuropathol Exp Neurol. 2016 May 27. |