Brand: | Abnova |
Reference: | H00056997-M02A |
Product name: | CABC1 monoclonal antibody (M02A), clone 6G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CABC1. |
Clone: | 6G10 |
Isotype: | IgM Kappa |
Gene id: | 56997 |
Gene name: | CABC1 |
Gene alias: | ADCK3|ARCA2|COQ8|MGC4849|SCAR9 |
Gene description: | chaperone, ABC1 activity of bc1 complex homolog (S. pombe) |
Genbank accession: | BC005171 |
Immunogen: | CABC1 (AAH05171, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD |
Protein accession: | AAH05171 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | CABC1 monoclonal antibody (M02A), clone 6G10 Western Blot analysis of CABC1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |