CABC1 polyclonal antibody (A01) View larger

CABC1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CABC1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CABC1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00056997-A01
Product name: CABC1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CABC1.
Gene id: 56997
Gene name: CABC1
Gene alias: ADCK3|ARCA2|COQ8|MGC4849|SCAR9
Gene description: chaperone, ABC1 activity of bc1 complex homolog (S. pombe)
Genbank accession: BC005171
Immunogen: CABC1 (AAH05171, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD
Protein accession: AAH05171
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056997-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CABC1 polyclonal antibody (A01) now

Add to cart