TULP4 monoclonal antibody (M05), clone 7B7 View larger

TULP4 monoclonal antibody (M05), clone 7B7

H00056995-M05_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TULP4 monoclonal antibody (M05), clone 7B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about TULP4 monoclonal antibody (M05), clone 7B7

Brand: Abnova
Reference: H00056995-M05
Product name: TULP4 monoclonal antibody (M05), clone 7B7
Product description: Mouse monoclonal antibody raised against a partial recombinant TULP4.
Clone: 7B7
Isotype: IgG2b Kappa
Gene id: 56995
Gene name: TULP4
Gene alias: KIAA1397|TUSP
Gene description: tubby like protein 4
Genbank accession: NM_001007466
Immunogen: TULP4 (NP_001007467.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLAT
Protein accession: NP_001007467.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056995-M05-1-9-1.jpg
Application image note: TULP4 monoclonal antibody (M05), clone 7B7. Western Blot analysis of TULP4 expression in K-562.
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy TULP4 monoclonal antibody (M05), clone 7B7 now

Add to cart