Brand: | Abnova |
Reference: | H00056995-M05 |
Product name: | TULP4 monoclonal antibody (M05), clone 7B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TULP4. |
Clone: | 7B7 |
Isotype: | IgG2b Kappa |
Gene id: | 56995 |
Gene name: | TULP4 |
Gene alias: | KIAA1397|TUSP |
Gene description: | tubby like protein 4 |
Genbank accession: | NM_001007466 |
Immunogen: | TULP4 (NP_001007467.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLAT |
Protein accession: | NP_001007467.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TULP4 monoclonal antibody (M05), clone 7B7. Western Blot analysis of TULP4 expression in K-562. |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |