Brand: | Abnova |
Reference: | H00056993-A03 |
Product name: | TOMM22 polyclonal antibody (A03) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TOMM22. |
Gene id: | 56993 |
Gene name: | TOMM22 |
Gene alias: | 1C9-2|MST065|MSTP065|TOM22 |
Gene description: | translocase of outer mitochondrial membrane 22 homolog (yeast) |
Genbank accession: | NM_020243 |
Immunogen: | TOMM22 (NP_064628, 12 a.a. ~ 84 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAA |
Protein accession: | NP_064628 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.14 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |