Brand: | Abnova |
Reference: | H00056993-A01 |
Product name: | TOMM22 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant TOMM22. |
Gene id: | 56993 |
Gene name: | TOMM22 |
Gene alias: | 1C9-2|MST065|MSTP065|TOM22 |
Gene description: | translocase of outer mitochondrial membrane 22 homolog (yeast) |
Genbank accession: | BC009363 |
Immunogen: | TOMM22 (AAH09363, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI |
Protein accession: | AAH09363 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (41.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | TOMM22 polyclonal antibody (A01), Lot # 051206JC01 Western Blot analysis of TOMM22 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |