DTWD1 monoclonal antibody (M02), clone 2E6 View larger

DTWD1 monoclonal antibody (M02), clone 2E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DTWD1 monoclonal antibody (M02), clone 2E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re

More info about DTWD1 monoclonal antibody (M02), clone 2E6

Brand: Abnova
Reference: H00056986-M02
Product name: DTWD1 monoclonal antibody (M02), clone 2E6
Product description: Mouse monoclonal antibody raised against a full-length recombinant DTWD1.
Clone: 2E6
Isotype: IgG2a Kappa
Gene id: 56986
Gene name: DTWD1
Gene alias: MDS009|MGC111207
Gene description: DTW domain containing 1
Genbank accession: NM_020234.3
Immunogen: DTWD1 (NP_064619.2, 1 a.a. ~ 304 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALIFPGPQSISIKDISFHLQKRIQNNVRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTTLKKIIFIDSTWNQTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDILKEKYRGQYDNLLFFYSFMYQLIKNAKCSGDKETGKLTH
Protein accession: NP_064619.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056986-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (61.6 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056986-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DTWD1 is 0.3 ng/ml as a capture antibody.
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DTWD1 monoclonal antibody (M02), clone 2E6 now

Add to cart