RGMA monoclonal antibody (M01), clone 6D7 View larger

RGMA monoclonal antibody (M01), clone 6D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RGMA monoclonal antibody (M01), clone 6D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about RGMA monoclonal antibody (M01), clone 6D7

Brand: Abnova
Reference: H00056963-M01
Product name: RGMA monoclonal antibody (M01), clone 6D7
Product description: Mouse monoclonal antibody raised against a partial recombinant RGMA.
Clone: 6D7
Isotype: IgG3 Kappa
Gene id: 56963
Gene name: RGMA
Gene alias: RGM
Gene description: RGM domain family, member A
Genbank accession: NM_020211
Immunogen: RGMA (NP_064596.1, 326 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPGR
Protein accession: NP_064596.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056963-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056963-M01-13-15-1.jpg
Application image note: Western Blot analysis of RGMA expression in transfected 293T cell line by RGMA monoclonal antibody (M01), clone 6D7.

Lane 1: RGMA transfected lysate (Predicted MW: 49.5 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RGMA monoclonal antibody (M01), clone 6D7 now

Add to cart