> >>PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)
PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P) View larger

PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00056952-B01P
Product name: PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PRTFDC1 protein.
Gene id: 56952
Gene name: PRTFDC1
Gene alias: FLJ11888|HHGP
Gene description: phosphoribosyl transferase domain containing 1
Genbank accession: NM_020200.5
Immunogen: PRTFDC1 (NP_064585.1, 1 a.a. ~ 225 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV
Protein accession: NP_064585.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056952-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PRTFDC1 expression in transfected 293T cell line (H00056952-T01) by PRTFDC1 MaxPab polyclonal antibody.

Lane 1: PRTFDC1 transfected lysate(24.75 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart