SMYD2 MaxPab rabbit polyclonal antibody (D01) View larger

SMYD2 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMYD2 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about SMYD2 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00056950-D01
Product name: SMYD2 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human SMYD2 protein.
Gene id: 56950
Gene name: SMYD2
Gene alias: HSKM-B|KMT3C|MGC119305|ZMYND14
Gene description: SET and MYND domain containing 2
Genbank accession: NM_020197
Immunogen: SMYD2 (NP_064582.1, 1 a.a. ~ 433 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Protein accession: NP_064582.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00056950-D01-13-15-1.jpg
Application image note: Western Blot analysis of SMYD2 expression in transfected 293T cell line (H00056950-T02) by SMYD2 MaxPab polyclonal antibody.

Lane 1: SMYD2 transfected lysate(49.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy SMYD2 MaxPab rabbit polyclonal antibody (D01) now

Add to cart