Brand: | Abnova |
Reference: | H00056940-D01 |
Product name: | DUSP22 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human DUSP22 protein. |
Gene id: | 56940 |
Gene name: | DUSP22 |
Gene alias: | JKAP|JSP1|MKPX|VHX |
Gene description: | dual specificity phosphatase 22 |
Genbank accession: | NM_020185 |
Immunogen: | DUSP22 (NP_064570.1, 1 a.a. ~ 184 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL |
Protein accession: | NP_064570.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of DUSP22 transfected lysate using anti-DUSP22 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DUSP22 purified MaxPab mouse polyclonal antibody (B01P) (H00056940-B01P). |
Applications: | IF,WB-Tr,IP |
Shipping condition: | Dry Ice |