Brand: | Abnova |
Reference: | H00056925-M01 |
Product name: | LXN monoclonal antibody (M01), clone 8H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LXN. |
Clone: | 8H5 |
Isotype: | IgG2a Kappa |
Gene id: | 56925 |
Gene name: | LXN |
Gene alias: | ECI|TCI |
Gene description: | latexin |
Genbank accession: | NM_020169 |
Immunogen: | LXN (NP_064554.2, 151 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE |
Protein accession: | NP_064554.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | LXN monoclonal antibody (M01), clone 8H5. Western Blot analysis of LXN expression in MCF-7. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |