C1GALT1 polyclonal antibody (A01) View larger

C1GALT1 polyclonal antibody (A01)

H00056913-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1GALT1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about C1GALT1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00056913-A01
Product name: C1GALT1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant C1GALT1.
Gene id: 56913
Gene name: C1GALT1
Gene alias: C1GALT|T-synthase
Gene description: core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Genbank accession: NM_020156
Immunogen: C1GALT1 (NP_064541, 264 a.a. ~ 363 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP
Protein accession: NP_064541
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056913-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056913-A01-1-12-1.jpg
Application image note: C1GALT1 polyclonal antibody (A01), Lot # 060109JC01 Western Blot analysis of C1GALT1 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Elevated expression of L-selectin ligand in lymph node-derived human prostate cancer cells correlates with increased tumorigenicity.Radhakrishnan P, Lin MF, Cheng PW.
Glycoconj J. 2009 Jan;26(1):75-81. Epub 2008 Aug 1.

Reviews

Buy C1GALT1 polyclonal antibody (A01) now

Add to cart