TMEM167B (Human) Recombinant Protein (P02) View larger

TMEM167B (Human) Recombinant Protein (P02)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEM167B (Human) Recombinant Protein (P02)

BrandAbnova
Product typeProteins
ApplicationsAP,Array,ELISA,WB-Re

More info about TMEM167B (Human) Recombinant Protein (P02)

Brand: Abnova
Reference: H00056900-P02
Product name: TMEM167B (Human) Recombinant Protein (P02)
Product description: Human TMEM167B full-length ORF (NP_064526.1, 1 a.a. - 74 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 56900
Gene name: TMEM167B
Gene alias: AD-020|C1orf119|FLJ90710
Gene description: transmembrane protein 167B
Genbank accession: NM_020141.3
Immunogen sequence/protein sequence: MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACVVMAFYVLFIK
Protein accession: NP_064526.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00056900-P02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TMEM167B (Human) Recombinant Protein (P02) now

Add to cart