SLC2A4RG monoclonal antibody (M02), clone 4C10 View larger

SLC2A4RG monoclonal antibody (M02), clone 4C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC2A4RG monoclonal antibody (M02), clone 4C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about SLC2A4RG monoclonal antibody (M02), clone 4C10

Brand: Abnova
Reference: H00056731-M02
Product name: SLC2A4RG monoclonal antibody (M02), clone 4C10
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC2A4RG.
Clone: 4C10
Isotype: IgG2a Kappa
Gene id: 56731
Gene name: SLC2A4RG
Gene alias: GEF|HDBP1|Si-1-2|Si-1-2-19
Gene description: SLC2A4 regulator
Genbank accession: NM_020062
Immunogen: SLC2A4RG (NP_064446, 178 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPTASM
Protein accession: NP_064446
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056731-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056731-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to SLC2A4RG on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC2A4RG monoclonal antibody (M02), clone 4C10 now

Add to cart