Brand: | Abnova |
Reference: | H00056729-M25 |
Product name: | RETN monoclonal antibody (M25), clone 2H8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RETN. |
Clone: | 2H8 |
Isotype: | IgG2a Kappa |
Gene id: | 56729 |
Gene name: | RETN |
Gene alias: | ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1 |
Gene description: | resistin |
Genbank accession: | NM_020415 |
Immunogen: | RETN (NP_065148, 20 a.a. ~ 106 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV* |
Protein accession: | NP_065148 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |