JPH1 monoclonal antibody (M04), clone 2E6 View larger

JPH1 monoclonal antibody (M04), clone 2E6

H00056704-M04_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of JPH1 monoclonal antibody (M04), clone 2E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about JPH1 monoclonal antibody (M04), clone 2E6

Brand: Abnova
Reference: H00056704-M04
Product name: JPH1 monoclonal antibody (M04), clone 2E6
Product description: Mouse monoclonal antibody raised against a partial recombinant JPH1.
Clone: 2E6
Isotype: IgG2a Kappa
Gene id: 56704
Gene name: JPH1
Gene alias: DKFZp762L0313|JP-1|JP1
Gene description: junctophilin 1
Genbank accession: NM_020647
Immunogen: JPH1 (NP_065698, 501 a.a. ~ 579 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSA
Protein accession: NP_065698
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056704-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.43 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056704-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged JPH1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy JPH1 monoclonal antibody (M04), clone 2E6 now

Add to cart