DIABLO monoclonal antibody (M02A), clone 4F9 View larger

DIABLO monoclonal antibody (M02A), clone 4F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DIABLO monoclonal antibody (M02A), clone 4F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Tr

More info about DIABLO monoclonal antibody (M02A), clone 4F9

Brand: Abnova
Reference: H00056616-M02A
Product name: DIABLO monoclonal antibody (M02A), clone 4F9
Product description: Mouse monoclonal antibody raised against a partial recombinant DIABLO.
Clone: 4F9
Isotype: IgG2a Kappa
Gene id: 56616
Gene name: DIABLO
Gene alias: DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3
Gene description: diablo homolog (Drosophila)
Genbank accession: BC011909
Immunogen: DIABLO (AAH11909, 119 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQ
Protein accession: AAH11909
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056616-M02A-13-15-1.jpg
Application image note: Western Blot analysis of DIABLO expression in transfected 293T cell line by DIABLO monoclonal antibody (M02A), clone 4F9.

Lane 1: DIABLO transfected lysate(27.131 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DIABLO monoclonal antibody (M02A), clone 4F9 now

Add to cart