Cart 253 Product Products 81 201,34 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Mouse...290,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Bovine...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
1 x Mouse...290,00 € -
1 x Mouse...290,00 € -
1 x Mouse...290,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x AR...259,07 € -
1 x PRIC285...259,07 € -
-
-
-
1 x p21...259,07 € -
1 x SSBP2...259,07 € -
1 x MGST3...259,07 € -
-
-
-
1 x ATR...259,07 € -
1 x Tensin-2...259,07 € -
-
-
1 x DNA pol β...259,07 € -
-
-
1 x CaMKIα...259,07 € -
-
-
1 x p18...259,07 € -
1 x RIAM...259,07 € -
-
-
-
1 x MSK1...259,07 € -
-
-
-
-
1 x SR-7...259,07 € -
-
-
1 x N/H/K-Ras...259,07 € -
-
-
1 x DHHC-15...259,07 € -
-
-
1 x TPO...259,07 € -
-
1 x Elf-4...259,07 € -
-
-
1 x SR-6...259,07 € -
-
1 x CLC-7...259,07 € -
1 x DRS-1...259,07 € -
1 x MSY2...259,07 € -
-
-
-
-
1 x AR...259,07 € -
1 x NTR2...259,07 € -
1 x MGST1...259,07 € -
-
-
-
-
-
1 x MST-3...259,07 € -
1 x MZF-1...259,07 € -
1 x BACE...259,07 € -
-
-
1 x AKAP 14...259,07 € -
-
-
-
-
1 x Enolase...259,07 € -
1 x PD-ECGF...259,07 € -
-
No products
To be determined Shipping
81 201,34 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 253 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 81 201,34 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 81 201,34 €
Data sheet of DIABLO purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about DIABLO purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00056616-D01P |
| Product name: | DIABLO purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human DIABLO protein. |
| Gene id: | 56616 |
| Gene name: | DIABLO |
| Gene alias: | DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3 |
| Gene description: | diablo homolog (Drosophila) |
| Genbank accession: | NM_019887 |
| Immunogen: | DIABLO (NP_063940.1, 1 a.a. ~ 239 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |
| Protein accession: | NP_063940.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of DIABLO expression in transfected 293T cell line (H00056616-T01) by DIABLO MaxPab polyclonal antibody. Lane 1: DIABLO transfected lysate(27.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |