TUBB4Q MaxPab mouse polyclonal antibody (B01) View larger

TUBB4Q MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TUBB4Q MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IF,WB-Tr

More info about TUBB4Q MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00056604-B01
Product name: TUBB4Q MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human TUBB4Q protein.
Gene id: 56604
Gene name: TUBB4Q
Gene alias: -
Gene description: tubulin, beta polypeptide 4, member Q
Genbank accession: BC146475
Immunogen: TUBB4Q (AAI46476.1, 1 a.a. ~ 434 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRELVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVHHHEASGGRYVSRAVLVDLEPGTMDSVRSGPFGQVFRPDNFISRQCGAGNNWAKGRYTEGAELTESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIWEEYPDRIINTLSILLLPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCLCFPDQLNADLRKLAMNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMMAARDPRHGRYLTAAAIFQGRMPMREVDEQMFNIQDKNSSYFADWFPNNVKTAVCDIPPWGLKMSVTFTGNNTAVQELKRVSEQFTATFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEGGGV
Protein accession: AAI46476.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056604-B01-13-15-1.jpg
Application image note: Western Blot analysis of TUBB4Q expression in transfected 293T cell line (H00056604-T01) by TUBB4Q MaxPab polyclonal antibody.

Lane 1: TUBB4Q transfected lysate(47.74 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TUBB4Q MaxPab mouse polyclonal antibody (B01) now

Add to cart