CYP26B1 (Human) Recombinant Protein (Q01) View larger

CYP26B1 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYP26B1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CYP26B1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00056603-Q01
Product name: CYP26B1 (Human) Recombinant Protein (Q01)
Product description: Human CYP26B1 partial ORF ( NP_063938, 131 a.a. - 230 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 56603
Gene name: CYP26B1
Gene alias: CYP26A2|DKFZp686G0638|MGC129613|P450RAI-2
Gene description: cytochrome P450, family 26, subfamily B, polypeptide 1
Genbank accession: NM_019885
Immunogen sequence/protein sequence: SNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPF
Protein accession: NP_063938
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00056603-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CYP26B1 (Human) Recombinant Protein (Q01) now

Add to cart