Brand: | Abnova |
Reference: | H00056603-M02 |
Product name: | CYP26B1 monoclonal antibody (M02), clone 2G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CYP26B1. |
Clone: | 2G7 |
Isotype: | IgG2a Kappa |
Gene id: | 56603 |
Gene name: | CYP26B1 |
Gene alias: | CYP26A2|DKFZp686G0638|MGC129613|P450RAI-2 |
Gene description: | cytochrome P450, family 26, subfamily B, polypeptide 1 |
Genbank accession: | NM_019885 |
Immunogen: | CYP26B1 (NP_063938, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPF |
Protein accession: | NP_063938 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CYP26B1 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |