Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00056477-B01P |
Product name: | CCL28 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human CCL28 protein. |
Gene id: | 56477 |
Gene name: | CCL28 |
Gene alias: | CCK1|MEC|MGC71902|SCYA28 |
Gene description: | chemokine (C-C motif) ligand 28 |
Genbank accession: | NM_148672.2 |
Immunogen: | CCL28 (NP_683513.1, 1 a.a. ~ 127 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
Protein accession: | NP_683513.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CCL28 expression in transfected 293T cell line (H00056477-T01) by CCL28 MaxPab polyclonal antibody. Lane1:CCL28 transfected lysate(13.97 KDa). Lane2:Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |