CCL28 MaxPab mouse polyclonal antibody (B01) View larger

CCL28 MaxPab mouse polyclonal antibody (B01)

H00056477-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCL28 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CCL28 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00056477-B01
Product name: CCL28 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CCL28 protein.
Gene id: 56477
Gene name: CCL28
Gene alias: CCK1|MEC|MGC71902|SCYA28
Gene description: chemokine (C-C motif) ligand 28
Genbank accession: NM_148672.2
Immunogen: CCL28 (NP_683513.1, 1 a.a. ~ 127 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Protein accession: NP_683513.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056477-B01-13-15-1.jpg
Application image note: Western Blot analysis of CCL28 expression in transfected 293T cell line (H00056477-T01) by CCL28 MaxPab polyclonal antibody.

Lane1:CCL28 transfected lysate(13.97 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CCL28 MaxPab mouse polyclonal antibody (B01) now

Add to cart