Brand: | Abnova |
Reference: | H00056341-A01 |
Product name: | HRMT1L4 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant HRMT1L4. |
Gene id: | 56341 |
Gene name: | PRMT8 |
Gene alias: | HRMT1L3|HRMT1L4 |
Gene description: | protein arginine methyltransferase 8 |
Genbank accession: | NM_019854 |
Immunogen: | HRMT1L4 (NP_062828, 235 a.a. ~ 334 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | CLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR |
Protein accession: | NP_062828 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |