Brand: | Abnova |
Reference: | H00056300-M02 |
Product name: | IL1F9 monoclonal antibody (M02), clone 2A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IL1F9. |
Clone: | 2A8 |
Isotype: | IgG1 Kappa |
Gene id: | 56300 |
Gene name: | IL1F9 |
Gene alias: | IL-1F9|IL-1H1|IL-1RP2|IL1E|IL1H1|IL1RP2 |
Gene description: | interleukin 1 family, member 9 |
Genbank accession: | NM_019618 |
Immunogen: | IL1F9 (NP_062564, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQ |
Protein accession: | NP_062564 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged IL1F9 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |