CPXM1 monoclonal antibody (M02), clone 2G5 View larger

CPXM1 monoclonal antibody (M02), clone 2G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPXM1 monoclonal antibody (M02), clone 2G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about CPXM1 monoclonal antibody (M02), clone 2G5

Brand: Abnova
Reference: H00056265-M02
Product name: CPXM1 monoclonal antibody (M02), clone 2G5
Product description: Mouse monoclonal antibody raised against a partial recombinant CPXM1.
Clone: 2G5
Isotype: IgG2b Kappa
Gene id: 56265
Gene name: CPXM1
Gene alias: CPX1|CPXM
Gene description: carboxypeptidase X (M14 family), member 1
Genbank accession: NM_019609
Immunogen: CPXM1 (NP_062555, 610 a.a. ~ 718 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDYWRLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKV
Protein accession: NP_062555
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056265-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056265-M02-13-15-1.jpg
Application image note: Western Blot analysis of CPXM1 expression in transfected 293T cell line by CPXM1 monoclonal antibody (M02), clone 2G5.

Lane 1: CPXM1 transfected lysate (Predicted MW: 81.7 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CPXM1 monoclonal antibody (M02), clone 2G5 now

Add to cart