Cart 194 Product Products 63 067,80 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Mouse...290,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Bovine...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
1 x Mouse...290,00 € -
1 x Mouse...290,00 € -
1 x Mouse...290,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x AR...259,07 € -
1 x PRIC285...259,07 € -
-
-
-
1 x p21...259,07 € -
1 x SSBP2...259,07 € -
1 x MGST3...259,07 € -
-
-
-
1 x ATR...259,07 € -
1 x Tensin-2...259,07 € -
-
-
1 x DNA pol β...259,07 € -
No products
To be determined Shipping
63 067,80 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 194 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 63 067,80 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 63 067,80 €
Data sheet of ZNF253 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce |
More info about ZNF253 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00056242-D01P |
| Product name: | ZNF253 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ZNF253 protein. |
| Gene id: | 56242 |
| Gene name: | ZNF253 |
| Gene alias: | BMZF-1|BMZF1|FLJ90391|ZNF411 |
| Gene description: | zinc finger protein 253 |
| Genbank accession: | NM_021047.2 |
| Immunogen: | ZNF253 (NP_066385.2, 1 a.a. ~ 499 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRDVMLENYRNLVFLGIVVSKPDLVTCLEQGKKPLTMERHEMIAKPPVMSSHFAQDLWPENIQNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYNGLNQCLTTTQKEIFQCDKYGKVFHKFSNSNTYKTRHTGINLFKCIICGKAFKRSSTLTTHKKIHTGEKPYRCEECGKAFNQSANLTTHKRIHTGEKPYRCEECGKAFKQSSNLTTHKKIHTGEKPYKCEECGKAFNRSTDLTTHKIVHTGEKPYKCEECGKAFKHPSHVTTHKKIHTRGKPYNCEECGKSFKHCSNLTIHKRIHTGEKPYKCEECGKAFHLSSHLTTHKILHTGEKPYRCRECGKAFNHSTTLFSHEKIHTGEKPYKCDECGKTFTWPSILSKHKRTHTGEKPYKCEECGKSFTASSTLTTHKRIHTGEKPYKCEECGKAFNWSSDLNKHKKIHIERKPYIVKNVTDLLNVPPLLISIR |
| Protein accession: | NP_066385.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ZNF253 MaxPab rabbit polyclonal antibody. Western Blot analysis of ZNF253 expression in Jurkat. |
| Applications: | WB-Ce |
| Shipping condition: | Dry Ice |