PCDHA5 monoclonal antibody (M01A), clone 1E8 View larger

PCDHA5 monoclonal antibody (M01A), clone 1E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDHA5 monoclonal antibody (M01A), clone 1E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PCDHA5 monoclonal antibody (M01A), clone 1E8

Brand: Abnova
Reference: H00056143-M01A
Product name: PCDHA5 monoclonal antibody (M01A), clone 1E8
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDHA5.
Clone: 1E8
Isotype: IgM Kappa
Gene id: 56143
Gene name: PCDHA5
Gene alias: CNR6|CNRN6|CNRS6|CRNR6|PCDH-ALPHA5
Gene description: protocadherin alpha 5
Genbank accession: NM_018908
Immunogen: PCDHA5 (NP_061731, 183 a.a. ~ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TNEEETNFLELVLRKSLDREETQEHRLLVIATDGGKPELTGTVQLLINVLDANDNAPEFDKSIYNVRLLENAPSGTLVIKLNASDADEGINKEIVYFFSNLVLDDVK
Protein accession: NP_061731
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056143-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056143-M01A-1-1-1.jpg
Application image note: PCDHA5 monoclonal antibody (M01A), clone 1E8 Western Blot analysis of PCDHA5 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCDHA5 monoclonal antibody (M01A), clone 1E8 now

Add to cart